PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03016.1.g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 536aa    MW: 58621.2 Da    PI: 9.1293
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03016.1.g00110.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.32.3e-06236268434
                      zf-B_box   4 rkCpeHeekelqlfCedCqqllCedCllee..H 34 
                                   r C+ ++ + ++l+C+ +  +lC+ C      H
  Zmw_sc03016.1.g00110.1.am.mk 236 RPCDACGAEAARLYCRADAAFLCAGCXXXXsrH 268
                                   68************************9876666 PP

2zf-B_box21.54.9e-07271313339
                      zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39 
                                    + C+ +e+ +++  C+ +   lC++C   +H+       H++
  Zmw_sc03016.1.g00110.1.am.mk 271 VWLCEVCEHAPASVTCRADAAALCASCDADIHSAnplarrHER 313
                                   679*****************************65777777775 PP

3CCT68.91.3e-23453496144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Zmw_sc03016.1.g00110.1.am.mk 453 REARLMRYREKRKSRRFEKTIRYASRKACAETRPRIKGRFAKRT 496
                                   9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.0E-4233273IPR000315B-box-type zinc finger
PROSITE profilePS501199.855233268IPR000315B-box-type zinc finger
CDDcd000217.68E-6236273No hitNo description
PROSITE profilePS5011910.395269316IPR000315B-box-type zinc finger
PfamPF006431.7E-5271315IPR000315B-box-type zinc finger
CDDcd000211.86E-7272316No hitNo description
SMARTSM003369.5E-10274316IPR000315B-box-type zinc finger
PfamPF062035.7E-18453495IPR010402CCT domain
PROSITE profilePS5101716.618453495IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MQPFSTTTTL AKYQSPEALD LQNVLDAIIL PLSVPPRARI ADTAGEQPSR RPMEIRATSR  60
QPMARCHLFP RRLRRWEWDG RPPPTHGPPV PVASHNLPCL NARPIFLRQR PAFPHPARGR  120
RRCVNHRAYV PVGVGFYRLY RARSRGLDRS GEAGVRLGDG EARKAGTGKH GHWRTNSAPA  180
RRESDSRGQH CLHVAPATAR YELHCRVRRC RQFRVIAMAG DEKSSVGGSY WGLNTRPCDA  240
CGAEAARLYC RADAAFLCAG CXXXXSRHAR VWLCEVCEHA PASVTCRADA AALCASCDAD  300
IHSANPLARR HERFPVAPFY GALADAPKPF ASSAAAAPKP GAAVDDDRSN EAEAASWLLP  360
EPDHGQKDGS SAEVFFADSD TYLDLDFARS MDDVKAIGVQ NCPPEMDLTG AKLFYPDHSV  420
NHSVSSSEAA VVPDAAAASA APPAPVVSRG REREARLMRY REKRKSRRFE KTIRYASRKA  480
CAETRPRIKG RFAKRTSAGA AAEAEEEHDE EMYSSAAAAL LAPAAADVDY GVVPTF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008663359.11e-158PREDICTED: zinc finger protein CONSTANS-LIKE 3-like
TrEMBLK7UJZ21e-158K7UJZ2_MAIZE; C2C2-CO-like transcription factor
STRINGAC233888.1_FGP0021e-157(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272